Quick recipes with pasta and peas
Got pasta and peas and not sure what to make? Here are 8 easy dinners you can cook tonight. Each one keeps to everyday ingredients and a single skillet or sheet pan where possible, with rough prep and cook times so you can pick by how much time you have. Prefer to cook with exactly what's on your shelf? Tell Cache & Cook what you have and it drafts a recipe free.
Creamy Garlic Pasta with Peas and Parmesan
15 min Serves 4weeknightitalianvegetarian
Spring Garlic Pasta with Peas and Lemon
15 min Serves 4weeknightitalian-inspiredvegetarian
Pasta with Charred Garlic, Chili, and Peas
15 min Serves 4weeknightvegetarianspicy
Creamy Garlic Pasta with Peas and Crispy Pancetta
15 min Serves 4weeknightitalian-inspiredcreamy
Creamy Garlic Pasta with Crispy Pancetta and Peas
15 min Serves 4weeknightitalian-inspiredcreamy
Lemon-Butter Pasta with Peas and Crispy Shallots
15 min Serves 4weeknightvegetarian30-minutes-or-less
Creamy Lemon Pasta with Peas and Crispy Garlic
15 min Serves 4weeknightitalian-inspiredcomfort food
Garlic-Butter Pasta with Spring Peas and Lemon
15 min Serves 4weeknightvegetarianlight
More ideas
Common questions
- Can I use frozen peas instead of fresh peas?
- Yes, frozen peas work great and are often more convenient and affordable than fresh ones. Simply add them directly to your pasta dish during the last 2-3 minutes of cooking, or thaw them first if you prefer.
- What can I substitute for peas if I don't have any?
- You can use other vegetables like green beans, corn, broccoli, or zucchini as alternatives that work similarly in pasta dishes. Adjust cooking times slightly depending on the vegetable's density.
- How do I store leftover pasta and peas?
- Keep leftovers in an airtight container in the refrigerator for up to 3-4 days, or freeze for up to 2-3 months. Reheat gently on the stovetop with a splash of water or olive oil to restore the texture.
- What can I serve alongside pasta and peas to make a complete meal?
- A simple green salad, crusty bread, or garlic bread pairs perfectly and requires minimal extra cooking. For a heartier meal, add grilled chicken, meatballs, or a dollop of ricotta on top.
- How can I make pasta and peas healthier?
- Use whole wheat or legume-based pasta for extra fiber and protein, add more vegetables like spinach or tomatoes, and use olive oil or light cream instead of heavy sauces. Keeping portion sizes moderate and adding lean protein also boosts the nutritional value.