Cache & Cook

Ginger-Scallion Rice with Crispy Tofu and Quick Pickled Cucumber

weeknightvegetarianfreshasian-inspired
15 minPrep25 minCook4Serves

Ingredients

  • 1½ cupslong-grain white rice
  • 3 cupswater
  • ·salt
  • 14 ouncesfirm tofu
  • 3 tablespoonsneutral oil
  • 1cucumber (English or seedless)
  • 2 tablespoonsrice vinegar
  • 1 teaspoonsugar
  • 2 tablespoonsfresh ginger
  • 4scallion
  • 1 tablespoonsesame oil
  • 1 tablespoonsoy sauce

Prep

  1. 01

    Peel and mince 2 tablespoons fresh ginger.

  2. 02

    Trim and thinly slice 4 scallions, keeping white and light green parts separate from dark green tops.

  3. 03

    Slice 1 English cucumber into thin half-moons or matchsticks.

Method

  1. 01

    Rinse rice under cold water until the water runs mostly clear. In a saucepan, combine rice, 3 cups water, and a pinch of salt. Bring to a boil, then reduce heat to low, cover, and simmer for 18 minutes. Remove from heat and let sit covered for 5 minutes.

  2. 02

    While rice cooks, press tofu between paper towels for 2 minutes to remove excess moisture. Cut into 3/4-inch cubes.

  3. 03

    Heat neutral oil in a large skillet over medium-high heat. Working in batches, pan-fry tofu until all sides are golden and crispy, about 8–10 minutes total. Transfer to a plate.

  4. 04

    In a small bowl, whisk together rice vinegar, sugar, and a pinch of salt until sugar dissolves. Add cucumber and let sit until rice is done.

  5. 05

    Fluff cooked rice with a fork. Divide among bowls and top with crispy tofu. Drizzle each bowl with sesame oil and soy sauce. Scatter warm ginger and scallion over the top, then add a spoonful of pickled cucumber and its liquid.

  6. 06

    Serve immediately while the tofu is still warm.

Spice Tips

For warmth, add a small pinch of white pepper or a few flakes of red chili to the ginger-scallion topping. A squeeze of fresh lime juice brightens the whole bowl. If you prefer more umami depth, whisk a teaspoon of miso into the sesame oil–soy sauce drizzle.

Tofu can be pressed and cubed up to 4 hours ahead; store in the fridge. Pickled cucumber can be made up to 2 hours in advance. For a protein swap, use shrimp or chicken instead of tofu.

Want recipes from your fridge? Cache & Cook drafts them free.

Try it free