Quick recipes with cauliflower and chickpeas
Got cauliflower and chickpeas and not sure what to make? Here are 8 easy dinners you can cook tonight. Each one keeps to everyday ingredients and a single skillet or sheet pan where possible, with rough prep and cook times so you can pick by how much time you have. Prefer to cook with exactly what's on your shelf? Tell Cache & Cook what you have and it drafts a recipe free.
Roasted Cauliflower and Chickpeas with Warm Spiced Yogurt
25 min Serves 4weeknightvegetariancomforting
Crispy Cauliflower & Chickpeas with Lemon-Tahini Drizzle
25 min Serves 4weeknightvegetarianmiddle-eastern-inspired
Charred Cauliflower & Chickpeas with Chili-Lime Drizzle
15 min Serves 4weeknightvegetarianspicy
Crispy Cauliflower and Chickpeas with Warm Garlic Oil
20 min Serves 4weeknightvegetarianone-pan
Crispy Chickpea & Cauliflower Curry with Yogurt
30 min Serves 4weeknightvegetariancurry
Citrus-Spiced Cauliflower and Chickpea Skillet
18 min Serves 4weeknightvegetarian30-minutes
Crispy Cauliflower and Chickpeas with Garlic Oil and Lemon
18 min Serves 4weeknightvegetarianunder-30-minutes
Crispy Cauliflower & Chickpeas with Tahini-Lemon Drizzle
15 min Serves 4weeknightvegetarianfresh
More ideas
Common questions
- Can I use canned chickpeas instead of dried ones?
- Yes, canned chickpeas work great and save time—use about 1.5 cans (drained and rinsed) to replace 1 cup of dried chickpeas. Just skip the soaking and cooking step and add them partway through your recipe so they don't fall apart.
- How long can I store leftover cauliflower and chickpea dishes?
- Store in an airtight container in the refrigerator for up to 4 days, or freeze for up to 3 months. Roasted versions hold up better than curries when reheating.
- What should I serve with cauliflower and chickpea recipes?
- Pair with rice, quinoa, or flatbread to make it a complete meal, or serve over greens as a grain-free option. A squeeze of lemon or lime juice and fresh herbs like cilantro or parsley brighten any dish.
- How do I make these recipes cheaper?
- Buy dried chickpeas in bulk and cook them yourself instead of using canned, and use frozen cauliflower instead of fresh—it's often half the price and just as nutritious. Both freeze well, so you can buy on sale.
- Can I make this dish lower in carbs?
- Absolutely—use cauliflower rice or roasted cauliflower florets instead of grains, and skip any added sugars or sweeteners in sauces. The chickpeas provide protein and fiber, making the dish filling even without a grain base.